PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022542P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 77aa    MW: 8750.26 Da    PI: 11.6163
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022542P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.8e-302172253
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                    prlrWtp+LH++Fv a+e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ +
  MELO3C022542P1 21 PRLRWTPDLHHSFVLAIERLGGHQKATPKLVLQLMDVKGLTISHVKSHLQVF 72
                    8*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-281772IPR009057Homeodomain-like
SuperFamilySSF466893.23E-151974IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-232173IPR006447Myb domain, plants
PfamPF002492.9E-72271IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MSSNSCGRNG SVRQYIRSKV PRLRWTPDLH HSFVLAIERL GGHQKATPKL VLQLMDVKGL  60
TISHVKSHLQ VFFFFF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819049e-68LN681904.1 Cucumis melo genomic scaffold, anchoredscaffold00053.
GenBankLN7132649e-68LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460209.12e-45PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
SwissprotQ700D93e-29MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A0A0KSV16e-45A0A0A0KSV1_CUCSA; Uncharacterized protein
STRINGVIT_01s0137g00050.t019e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-30G2-like family protein